Basic Information | |
---|---|
IMG/M Taxon OID | 3300002750 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0095510 | Gp0072137 | Ga0007262 |
Sample Name | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE15-C |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 15030841 |
Sequencing Scaffolds | 0 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Switchgrass Rhizosphere Microbial Communities From Knoxville, Tennessee, Usa |
Type | Host-Associated |
Taxonomy | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Knoxville, Tennessee, Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | terrestrial biome → agricultural field → agricultural soil |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Wisconsin | |||||||
Coordinates | Lat. (o) | N/A | Long. (o) | -89.33 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F095664 | Metagenome / Metatranscriptome | 105 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
JGI25521J39329_1013 | JGI25521J39329_10131 | F095664 | EIWSNSLRLASTDTGPDADVPDHDAMVEWLTTYAKDAVAAWHGSFDLKCSNQAKLAYLKMNVVDIAGRYIEQNTLEYLYSPVVPGGSASNIHPTQIALAVSLTTEFSRGHAHRGRFYVPMPVHVVDATTGLISVSDAIQVATAAKTFIEALADEPGPDILPGMRVCVMSQRGTGATNVVTGVDV |
⦗Top⦘ |