Basic Information | |
---|---|
IMG/M Taxon OID | 3300002727 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053054 | Gp0056924 | Ga0005062 |
Sample Name | Soil microbial communities from Rifle, Colorado - Rifle Oxygen_injection B1 |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 105275472 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → Viruses → Predicted Viral | 1 |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella → Prevotella buccae | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Soil Microbial Communities From Rifle, Colorado, Usa |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | terrestrial biome → land → soil |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Rifle, Colorado, United States | |||||||
Coordinates | Lat. (o) | 39.534762 | Long. (o) | -107.782602 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F016087 | Metagenome / Metatranscriptome | 250 | Y |
F079636 | Metagenome | 115 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
C687J39217_1001934 | All Organisms → Viruses → Predicted Viral | 3725 | Open in IMG/M |
C687J39217_1036312 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella → Prevotella buccae | 597 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
C687J39217_1001934 | C687J39217_10019343 | F016087 | METFWKILNKLMDYLGTLAVALLFAMLAFSVGYHVGFSSGLDTKVTWVGEKYTMKVTGKAAKR* |
C687J39217_1036312 | C687J39217_10363121 | F079636 | GMYNINGNASSFGKFIADGSEAYNSYTIENPNLVNADGTINTLGETQVLGFDLTTNDSLVMPIRKEFEAHDDPTLLRKQKQGFFGWADLGFACLDSRMLGMGIIDRSL* |
⦗Top⦘ |