NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300002702

3300002702: Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Biofilm from sections of failed pipe of Encana Pipeline



Overview

Basic Information
IMG/M Taxon OID3300002702 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0047444 | Gp0091716 | Ga0024845
Sample NameWastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Biofilm from sections of failed pipe of Encana Pipeline
Sequencing StatusPermanent Draft
Sequencing CenterMcGill University
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size289715476
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Hydrogenedentes → unclassified Candidatus Hydrogenedentes → Candidatus Hydrogenedentes bacterium ADurb.Bin1701
All Organisms → cellular organisms → Bacteria2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHydrocarbon Resource Environments Microbial Communities From Canada And Usa
TypeEngineered
TaxonomyEngineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationFort McMurray, Alberta, Canda
CoordinatesLat. (o)55.07Long. (o)-110.53Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025668Metagenome200Y
F048134Metagenome / Metatranscriptome148Y
F086282Metagenome111N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
draft_10390299All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Hydrogenedentes → unclassified Candidatus Hydrogenedentes → Candidatus Hydrogenedentes bacterium ADurb.Bin170582Open in IMG/M
draft_10479190All Organisms → cellular organisms → Bacteria12132Open in IMG/M
draft_10479821All Organisms → cellular organisms → Bacteria30898Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
draft_10390299draft_103902991F086282FCSNFVIQRHCPVCNGYGAHKHGFYRRTLPDSAVQKVRVPRFLCLKCHKTFSCLPFCLVRRLGISLSGLLRCAASNDPWTVLEEVYMIARSTLWRWRRLGKKLLTALPELLAFFGDSWIEVSHTISRIQYPCSKLKPHPTQAGN*
draft_10479190draft_1047919012F048134MESSNNVQINLSIPEQYRNLLRRMAAERVMCDPSQVVTGASIATDLLLTALRKLAGEKNEGGNKS*
draft_10479821draft_1047982122F025668MIKLSIIEAQDYLRVKTEDGYKRIVDIHSLLKSHSINEVVLFLKDYLREKENSLRNMILIDKTHCKVDQIVASMFRITMAIKALKEGEEVISLEESQQRAETRRTIHKRNSRGHRSSWKRENKNHDGKNRVSGNPAKRAA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.