NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300002693

3300002693: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI072_165m_A (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300002693 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0046785 | Gp0055327 | Ga0005235
Sample NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI072_165m_A (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size51827826
Sequencing Scaffolds8
Novel Protein Genes9
Associated Families7

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter → Methylobacter luteus1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium3
Not Available2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei1
All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biome → coastal inlet → sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationBritish Columbia, Canada
CoordinatesLat. (o)48.7299Long. (o)-123.5699Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005649Metagenome / Metatranscriptome394Y
F039110Metagenome / Metatranscriptome164Y
F046847Metagenome / Metatranscriptome150N
F051054Metagenome / Metatranscriptome144N
F058538Metagenome / Metatranscriptome135N
F066454Metagenome / Metatranscriptome126N
F098440Metatranscriptome103Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0005235J37282_1004195All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter → Methylobacter luteus1340Open in IMG/M
Ga0005235J37282_1006310All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium740Open in IMG/M
Ga0005235J37282_1013221Not Available810Open in IMG/M
Ga0005235J37282_1017711Not Available704Open in IMG/M
Ga0005235J37282_1020475All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei740Open in IMG/M
Ga0005235J37282_1024610All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon901Open in IMG/M
Ga0005235J37282_1028713All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium924Open in IMG/M
Ga0005235J37282_1028714All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium750Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0005235J37282_1004195Ga0005235J37282_10041951F058538VYSQYETTVMNRRRLHHLLSWVNHELHLDYEVIQENRDVFYVIFHDLDILKTVAIQKHLKSNPHTAN*
Ga0005235J37282_1005890Ga0005235J37282_10058902F005649LSTTCYNRLTNSNGDNSLDGLVVDWHLANSEMGFDNYVEPTSDYQSTYALAA*
Ga0005235J37282_1006310Ga0005235J37282_10063101F066454MSIRFDVLILINSGVTDRSEIVERLGINIRSVSNCVRFLIKEGWVEYSREPVSAVGSVGYRITQVGIDKIKASTVDEYRQSPKRKIPDYEVMRSHLGVGDNVSRSELINLWNELTDYYLPYEGDKEFTGRRGLSSL*
Ga0005235J37282_1013221Ga0005235J37282_10132211F046847VNVMADEHTNGTDETPKSENEVVLSQSKLDKLIDKGFSKGANRAKSELAEQLGVDSIEQARELINAKRENDEANKSDLDKAAELINTLNGTIKGLEANNNEIKADMAVQKVVSENGIKDADYFKHLLATASASEGFEQDAFIEQLKGDKPYLFSGGEVTQPKKVDATSNRASLDVGERVKSARTMAELYALQNEL*
Ga0005235J37282_1017711Ga0005235J37282_10177112F039110MTKAVSKKADAKKTSAKYQLKALRDGSHGIDGGIYTYKKYDIITLSKKGHFDSMKELACFDEV*
Ga0005235J37282_1020475Ga0005235J37282_10204751F098440IVSPYVMKLNAPSVLPMVFDDPRRHTLEVTVEHKQGEMVHIKTNAPEVSSFKVTTNGVQRVLELNGEKLVVVDYTKADKKFKQVLLLPTGEHVTVSLDWATWNPLTNKVNMMIEAPTRKFNVNTNYDLTNIKAGKMMVKVHGENPLLGKFEIMRNGNWNVDATQIDAKWNGKATFAKGPLAVFSPIDTDAKVNYNFANMVLGANIEKTIVGQKWGLNVSQNKISLITGRP*
Ga0005235J37282_1024610Ga0005235J37282_10246101F051054KECDMRTIKLTTFNDLGDCDRQDVNDLISALVRMGYEVWMTDTFVCFNLGNEDVIKDEKNEEEK*
Ga0005235J37282_1028713Ga0005235J37282_10287131F066454MSIRFDVLILINSGVTDRSEIMERLGINIMSVSNCFRFLIKEGWVEYSREPVSAVGSVGYRITQVGIDKIKASTVDDYRKSPQRKVPDYEVMRSHLGVGGDVTRSELVNLWNELTDYYLPYEGDKEFTEIVVFPP*
Ga0005235J37282_1028714Ga0005235J37282_10287141F066454INSGVTDRSEIMERLGINIMSVSNCFRFLIKEGWVEYSREPVSAVGSVGYRITQVGIDKIKASTVDDYRKSPQRKVPDYEVMRSHLGVGGDVTRSELVNLWNELTDYYLPYEGDKEFTEIVVFPP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.