Sample 3300002679

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300002679

3300002679: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI074_165m_B (Metagenome Metatranscriptome)

Overview

Basic Information
IMG/M Taxon OID	3300002679 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0046785 \| Gp0055392 \| Ga0005262
Sample Name	Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI074_165m_B (Metagenome Metatranscriptome)
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	18894811
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → Viruses → Predicted Viral	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine biome → coastal inlet → sea water
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	British Columbia, Canada
Coordinates	Lat. (^o)	48.7299	Long. (^o)	-123.5699	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043154	Metagenome / Metatranscriptome	157	Y
F046847	Metagenome / Metatranscriptome	150	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0005262J37297_105310	Not Available	951	Open in IMG/M
Ga0005262J37297_107098	All Organisms → Viruses → Predicted Viral	1470	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0005262J37297_105310	Ga0005262J37297_1053101	F046847	MADEHTNGTDETPKSENEVVLSQSKLDKLIDKGFSKGANRAKSELAEQLGVDSIEQARELINAKRENDEANKSDLDKAAELINTLNGTIKGLEANNNEIKADMAVQKVVSENGIKDADYFKHLLATASASEGFEQDAFIEQLKGDKPYLFSGGEVTQPKKVDATSNRASLDVGERVKSARTMAELYALQNEL*
Ga0005262J37297_107098	Ga0005262J37297_1070981	F043154	MITKGVAKYVYLDSTEKFNGEDTGKYTLTVGLAPAEVKVLEDMGVKVRTVTDKDTGKEIRIRKFSTQYKLDDNMIQTVSGESIGTDFGSGSDVQVLWKAGNEHPTHGVATYLTAIKVADEHEPGYKGANEEISEFLTA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.