Sample 3300002633

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300002633

3300002633: Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A1-12

Overview

Basic Information
IMG/M Taxon OID	3300002633 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0095510 \| Gp0072079 \| Ga0007204
Sample Name	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A1-12
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	155092943
Sequencing Scaffolds	0
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	terrestrial biome → agricultural field → agricultural soil
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline)

Location Information
Location	USA: Wisconsin
Coordinates	Lat. (^o)	39.28846264	Long. (^o)	-89.38	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094081	Metagenome / Metatranscriptome	106	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI25463J38534_10039	JGI25463J38534_100392	F094081	MRDDQGKILKKEFVERFDKAKGRLQQSVPEIQHLLKTSNVVEAARKIIDPAQSIFKQFADDIQLKDLFAKAEALVANLTVAKSVSRDTPPTETSP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.