Basic Information | |
---|---|
IMG/M Taxon OID | 3300002633 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0095510 | Gp0072079 | Ga0007204 |
Sample Name | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A1-12 |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 155092943 |
Sequencing Scaffolds | 0 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | terrestrial biome → agricultural field → agricultural soil |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Wisconsin | |||||||
Coordinates | Lat. (o) | 39.28846264 | Long. (o) | -89.38 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F094081 | Metagenome / Metatranscriptome | 106 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
JGI25463J38534_10039 | JGI25463J38534_100392 | F094081 | MRDDQGKILKKEFVERFDKAKGRLQQSVPEIQHLLKTSNVVEAARKIIDPAQSIFKQFADDIQLKDLFAKAEALVANLTVAKSVSRDTPPTETSP |
⦗Top⦘ |