


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300002553 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0110108 | Gp0091711 | Ga0027016 |
| Sample Name | Bacteria associated with jakobid flagellates |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Genome Quebec |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 364065350 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → Predicted Viral | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Freshwater Jakobid Flagellates Associated Microbial Communities From Zagora City, Morocco |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Unclassified → Unclassified → Unclassified → Unclassified → Freshwater Jakobid Flagellates Associated → Freshwater Jakobid Flagellates Associated Microbial Communities From Zagora City, Morocco |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal corpus |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Eastern part of Anti-Atlas mountain range near Zagora City, Morocco | |||||||
| Coordinates | Lat. (o) | 30.350367 | Long. (o) | -5.836196 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F018530 | Metagenome / Metatranscriptome | 234 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| JakoDRAFT_10008535 | All Organisms → Viruses → Predicted Viral | 1652 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| JakoDRAFT_10008535 | JakoDRAFT_100085351 | F018530 | MTNVNRDTLQGLPGVTPMFQAFVQSVRLYTRDFPELNRLLSGEESTDRQIAWSVLDAVSDFNGTPHFTTLSLDDLLGRSLQYLLLRMTVISLIEQVGLLQTRNHINYSTGGINVGINDKTPLLMNWLQYFRAFTDQRKQQVKVALNIEGILGPTNSGVFSEYWAVNSTYAQF* |
| ⦗Top⦘ |