NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300002544

3300002544: Deep subsurface microbial communities from Mt. Terri, Switzerland - Autotrophic microbial communities BRH/17



Overview

Basic Information
IMG/M Taxon OID3300002544 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0103000 | Gp0061306 | Ga0006270
Sample NameDeep subsurface microbial communities from Mt. Terri, Switzerland - Autotrophic microbial communities BRH/17
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size118273023
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDeep Subsurface Microbial Communities From Mt. Terri Underground Rock Laboratory, Switzerland, That Are Autotrophic
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Deep Subsurface → Clay → Unclassified → Deep Subsurface → Deep Subsurface Microbial Communities From Mt. Terri Underground Rock Laboratory, Switzerland, That Are Autotrophic

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeboreholeclay soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationMt. Terri, Switzerland
CoordinatesLat. (o)47.379Long. (o)7.1648Alt. (m)N/ADepth (m)562.73
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013050Metagenome / Metatranscriptome275Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI25319J35699_1000761Not Available16119Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI25319J35699_1000761JGI25319J35699_10007615F013050MSKGKQPRTRVKVPKLLLSEIKDVFFKYNQEIGLEAAIF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.