Basic Information | |
---|---|
IMG/M Taxon OID | 3300002544 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0103000 | Gp0061306 | Ga0006270 |
Sample Name | Deep subsurface microbial communities from Mt. Terri, Switzerland - Autotrophic microbial communities BRH/17 |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 118273023 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Deep Subsurface Microbial Communities From Mt. Terri Underground Rock Laboratory, Switzerland, That Are Autotrophic |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Deep Subsurface → Clay → Unclassified → Deep Subsurface → Deep Subsurface Microbial Communities From Mt. Terri Underground Rock Laboratory, Switzerland, That Are Autotrophic |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | terrestrial biome → borehole → clay soil |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Mt. Terri, Switzerland | |||||||
Coordinates | Lat. (o) | 47.379 | Long. (o) | 7.1648 | Alt. (m) | N/A | Depth (m) | 562.73 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F013050 | Metagenome / Metatranscriptome | 275 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
JGI25319J35699_1000761 | Not Available | 16119 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
JGI25319J35699_1000761 | JGI25319J35699_10007615 | F013050 | MSKGKQPRTRVKVPKLLLSEIKDVFFKYNQEIGLEAAIF* |
⦗Top⦘ |