Basic Information | |
---|---|
IMG/M Taxon OID | 3300002338 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0055735 | Gp0057510 | Ga0004986 |
Sample Name | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI - N_134min_Aerobic no depletion (Metagenome Metatranscriptome) |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 875203 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa |
Type | Engineered |
Taxonomy | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment → Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Madison, WI, USA | |||||||
Coordinates | Lat. (o) | 43.078418 | Long. (o) | -89.386482 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F030134 | Metagenome / Metatranscriptome | 186 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
JGI24211J29976_10428 | Not Available | 702 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
JGI24211J29976_10428 | JGI24211J29976_104281 | F030134 | SFRTKMQTIYLKDKIQPVLQRFKLRSCNLSTVEQTDSLS*YILVDKIIQHRGSNHVYR* |
⦗Top⦘ |