| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300002259 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0110163 | Gp0085156 | Ga0022181 |
| Sample Name | Muck sample |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 16713791 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Petroleum Byproduct Microbial Communities From Gujarat, India |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Unclassified → Unclassified → Unclassified → Petroleum Byproduct → Petroleum Byproduct Microbial Communities From Gujarat, India |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | ||||||||
| Coordinates | Lat. (o) | 23.03142 | Long. (o) | 70.21517 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F037780 | Metagenome / Metatranscriptome | 167 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| meta401DRAFT_123737 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| meta401DRAFT_123737 | meta401DRAFT_1237372 | F037780 | GSAASGRPEGGDDDGTTPMQKSDLLIVARRPVKAGRAKEEMD* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |