NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300002229

3300002229: Marine microbial communities from the Baltic Sea - S2t7 FKBb (102N)



Overview

Basic Information
IMG/M Taxon OID3300002229 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0110183 | Gp0084987 | Ga0022165
Sample NameMarine microbial communities from the Baltic Sea - S2t7 FKBb (102N)
Sequencing StatusPermanent Draft
Sequencing CenterKarolinska Institutet
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size216790088
Sequencing Scaffolds11
Novel Protein Genes11
Associated Families10

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae1
All Organisms → Viruses → Predicted Viral2
All Organisms → Viruses1
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1021
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Microbial Communities From The Baltic Sea Examining Degradability Of Arctic, Terrigenous Carbon Compounds In The Sea
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea Examining Degradability Of Arctic, Terrigenous Carbon Compounds In The Sea

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biome → marine water body → sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationBaltic Sea
CoordinatesLat. (o)57.305Long. (o)20.074Alt. (m)N/ADepth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009073Metagenome / Metatranscriptome323Y
F012107Metagenome / Metatranscriptome283Y
F013062Metagenome / Metatranscriptome274Y
F020114Metagenome / Metatranscriptome226Y
F029603Metagenome / Metatranscriptome188N
F059986Metagenome / Metatranscriptome133N
F065801Metagenome / Metatranscriptome127N
F074884Metagenome / Metatranscriptome119N
F088307Metagenome / Metatranscriptome109N
F088762Metagenome / Metatranscriptome109Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
S2T2FKBb102_1076802Not Available740Open in IMG/M
S2T2FKBb102_1150573All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae760Open in IMG/M
S2T2FKBb102_1167443All Organisms → Viruses → Predicted Viral1810Open in IMG/M
S2T2FKBb102_1174660All Organisms → Viruses907Open in IMG/M
S2T2FKBb102_1209179Not Available522Open in IMG/M
S2T2FKBb102_1211482All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes708Open in IMG/M
S2T2FKBb102_1270769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102508Open in IMG/M
S2T2FKBb102_1504016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6917Open in IMG/M
S2T2FKBb102_1884102All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes660Open in IMG/M
S2T2FKBb102_1934141All Organisms → Viruses → Predicted Viral2047Open in IMG/M
S2T2FKBb102_1976659Not Available536Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
S2T2FKBb102_1076802S2T2FKBb102_10768021F088762LEELEQSYARSKSPTLPTVTAAVDEDEDDALSYFQKLAE*
S2T2FKBb102_1150573S2T2FKBb102_11505731F074884MKEEIKSKISDKIYPNELVRDLMDINDIIQNKRSELEQLKTREEVVNATSKIVRSYYDKR
S2T2FKBb102_1167443S2T2FKBb102_11674431F074884MKEEIKSNISDKIYPNELVRDLMDINDIIQNKRSELEQLKTREEVVNATSKIVRSYYDKR
S2T2FKBb102_1174660S2T2FKBb102_11746601F020114MTMKPQTFKHISRCIDKHGVHHLDALDDYGRHWYATMQQKEEPWLTYIQKWELRTH*
S2T2FKBb102_1209179S2T2FKBb102_12091792F009073MKNYQIILTSVLSFTVAYWIITGTAQQYVYFAGELNELGCTVIALTMGILSLIAVDYKKLINGLN*
S2T2FKBb102_1211482S2T2FKBb102_12114823F088307MTDAPWLDCMDGFKYSQEDDAAILDKAALKVSQILRISVGEIDKTKFVYLYTLLYNMMGQGPDGKPCEDGDENMRHWLNTHNTHLGFCPAAGLVNRMPEIIGYLESFL*
S2T2FKBb102_1270769S2T2FKBb102_12707691F013062RVAGGQEMTYGRSLQRHLDHFDLPTVFTEWAHLAQDRAGWHKLVTAPPFAIGKPFVRQPRGDTRVTPEDQRRAVAQRAAEVAERRAVFDANNNN*
S2T2FKBb102_1504016S2T2FKBb102_15040168F029603VVYTSTLGLISGEKSLKTFLPVDRGGKYAFIQIKASGYPQNLPKGPKCPKKYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE*
S2T2FKBb102_1884102S2T2FKBb102_18841022F065801MSNQEKKDRKRKSIELMESIKVKEWKKNQVFNEISSFEWVELKKVGN*
S2T2FKBb102_1934141S2T2FKBb102_19341413F059986MTLMDALILLGLILIIFGCIFYIIATIMIRHYDQKLWELDNKLKQDEKWRKEYKR*
S2T2FKBb102_1976659S2T2FKBb102_19766591F012107LSTKSARPSQNWYLSYVETNETNQMTRYDVRCGQAPWENTTTDLDSAIDLAYHLSEDYQCDVNIHYNHTGTIYTTVSNY*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.