| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300002222 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0099546 | Gp0055083 | Ga0005350 |
| Sample Name | Host-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge pinacoderm, lysed by bead beating |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 202598248 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → Predicted Viral | 1 |
| All Organisms → cellular organisms → Bacteria | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Host-Associated Microbial Community Of The Marine Sponge Aplysina Aerophoba From Gulf Of Piran, Adriatic Sea |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Host-Associated → Host-Associated Microbial Community Of The Marine Sponge Aplysina Aerophoba From Gulf Of Piran, Adriatic Sea |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal corpus |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Gulf of Piran, Adriatic Sea | |||||||
| Coordinates | Lat. (o) | 45.5099 | Long. (o) | 13.56 | Alt. (m) | N/A | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004532 | Metagenome / Metatranscriptome | 434 | Y |
| F027335 | Metagenome / Metatranscriptome | 195 | Y |
| F033719 | Metagenome | 176 | Y |
| F054214 | Metagenome / Metatranscriptome | 140 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| JGI24795J26692_1019803 | All Organisms → Viruses → Predicted Viral | 1806 | Open in IMG/M |
| JGI24795J26692_1061344 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| JGI24795J26692_1062872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 620 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| JGI24795J26692_1009590 | JGI24795J26692_10095901 | F004532 | SIGRNDSLRYFCLNREAVDYVLDEEKYTSHQSFVVKRHGGPNWSGLEAPNEEVRGRVTEKMHFWDDGPDDLTVVERDYDSLVGVSTLKPKQQESGIRKLRAFDHFTMVLGKAGGEAGLLALMESQSMRVRTYNMQDEQFAFHRALQSEEVRIQFRGDALDLSEFENVAVSPGEITIIPLGISHSVISVPPDSEDFLRLNFYSKLRWHVPIDPTRHVYNSTFTVETTVHKEADWWKTAANA |
| JGI24795J26692_1019803 | JGI24795J26692_10198031 | F054214 | DPWTEPIMRQAAEAGIKFSLQNLGGAELIKKTINGELHVSVYGSGGTGEPLVANVQHLGCTEGKHGVSNVTRYCTADLEKLVTEYMEESDRAKRLSLWKKFSRTYFVDDVVHYIIGWSNIRNYVWRDEVKNWERGPTQEYWHATGGLWRTWLEPK* |
| JGI24795J26692_1061344 | JGI24795J26692_10613442 | F033719 | ADILANGIPGARLVLLAGERHSYFFANPEASFKAIREFL* |
| JGI24795J26692_1062872 | JGI24795J26692_10628722 | F027335 | EYELALEENMIVALEINHHPVKLEHLLRVTADGAEILSTYPMEPELAPA* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |