| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300002152 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053054 | Gp0056923 | Ga0005061 |
| Sample Name | Groundwater microbial communities from Rifle, Colorado - Rifle Oxygen_injection A3 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 200118367 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria | 1 |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Soil Microbial Communities From Rifle, Colorado, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater biome → planetary subsurface zone → groundwater |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Rifle, Colorado, United States | |||||||
| Coordinates | Lat. (o) | 39.53 | Long. (o) | -107.78 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F017253 | Metagenome | 242 | Y |
| F035129 | Metagenome / Metatranscriptome | 173 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| C687J26660_1000865 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8312 | Open in IMG/M |
| C687J26660_1010022 | All Organisms → cellular organisms → Bacteria | 1896 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| C687J26660_1000865 | C687J26660_10008655 | F017253 | VHNAGSYTQGRTAGVSRSNRKAARAERCPPETTAAALDR* |
| C687J26660_1010022 | C687J26660_10100223 | F035129 | MKKVFICLFICAMPSTGFAASLSESIAIEFQEHGKFTGIIGKAYVTEKAVEVVTFAEQNGVVIPFAFIDTILEKESKTEGVYNVKCRNQLGVLSTGTIDLHDRLNPKIILTTDKGITVTNISNVGRKMKKEFMPKVDLGK* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |