NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300002150

3300002150: Host-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge mesohyl, lysed by bead beating



Overview

Basic Information
IMG/M Taxon OID3300002150 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0099546 | Gp0055080 | Ga0005347
Sample NameHost-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge mesohyl, lysed by bead beating
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size214938064
Sequencing Scaffolds2
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria1
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHost-Associated Microbial Community Of The Marine Sponge Aplysina Aerophoba From Gulf Of Piran, Adriatic Sea
TypeHost-Associated
TaxonomyHost-Associated → Porifera → Unclassified → Unclassified → Unclassified → Host-Associated → Host-Associated Microbial Community Of The Marine Sponge Aplysina Aerophoba From Gulf Of Piran, Adriatic Sea

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal corpus

Location Information
LocationGulf of Piran, Adriatic Sea
CoordinatesLat. (o)45.5099Long. (o)13.56Alt. (m)N/ADepth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004237Metagenome / Metatranscriptome447Y
F020116Metagenome / Metatranscriptome226Y
F105953Metagenome / Metatranscriptome100N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI24792J26632_1005602All Organisms → cellular organisms → Bacteria → Proteobacteria5131Open in IMG/M
JGI24792J26632_1065629All Organisms → cellular organisms → Bacteria568Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI24792J26632_1005602JGI24792J26632_10056024F004237MIDYDIADMMDGVKNMIEASDIRPGDQVLLLADRRSDSASMEAISAGLKFMGAEPMSLITEPISRYGRVPQAVLDAMHACDVVIWVWPVFITFTPGHRALGRKREESGTQLKEQRMKPYFIYFEGTPGLLARDYARFPNPVLWKLAEKVREVVAAGKVVRIEDDLGSHLTATYDGTRLYGMQFRAGDPPGRCHFPWGRCGVFNGGGKADGEVYLSCVQGVAGELPAPMKWVVKDSEVVEAEGGELAEECRQLFKNVPGSNRLVEIMFGYHPKASIQHGIADPMHWELISKMPWVGLGTDRKNPDFRHVDGSVMNARLYIDERLIVHEQGMLDRSLLHHPEVLEAASAYGDPYQVLAPVSHNAHGSGTLW*
JGI24792J26632_1007700JGI24792J26632_10077001F105953EPLHVAKGYPAKDERTTAAECLLLKPSEVLEQVEEGLSGGQHFELIENEDLMVEMTVRSDSQRIYHRGFNQDEVAFQLTGQRGTRTTQGEFMLDTGDMLWIPPGCSHRNIGDMLTTRIILYTRNPLTLSREYTSRAEQVGQAG*
JGI24792J26632_1065629JGI24792J26632_10656292F020116MSGVGTTHEDLEKYLAGHHLTGAGLRREGMAPPRTGATGAHWRWQGIYQGLLRSGEIVTVGPGGMTGMRSVTGIEATRFPIWMNVQILMPGERTQGHRNMR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.