Basic Information | |
---|---|
IMG/M Taxon OID | 3300002095 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053054 | Gp0055715 | Ga0005089 |
Sample Name | Groundwater microbial communities from Rifle, Colorado - Rifle Oxygen_injection C3 |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 73108706 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 3 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Soil Microbial Communities From Rifle, Colorado, Usa |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Soil Microbial Communities From Rifle, Colorado, Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Rifle, Colorado, USA | |||||||
Coordinates | Lat. (o) | 39.534762 | Long. (o) | -107.782602 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F050966 | Metagenome / Metatranscriptome | 144 | Y |
F100657 | Metagenome / Metatranscriptome | 102 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
C687J26659_1003241 | Not Available | 1994 | Open in IMG/M |
C687J26659_1007484 | Not Available | 1266 | Open in IMG/M |
C687J26659_1014075 | Not Available | 876 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
C687J26659_1003241 | C687J26659_10032411 | F050966 | MSGSMWQGMKTRHGDGTEALSEEMESNGSATPKSRRHP |
C687J26659_1007484 | C687J26659_10074841 | F100657 | IYMIYFINSHKEIMIMTQITISYTTSVXTPAGWRNETVTATVEVISPKRGRVLCVQDIGGNGNSGYGSRTGAKRQAYHVGGIAMREQGKIKNLSACCIL* |
C687J26659_1014075 | C687J26659_10140751 | F050966 | MRENLMSGSRWQGMKTRHGDGTEALSEEMESNGSATPK |
⦗Top⦘ |