NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300002095

3300002095: Groundwater microbial communities from Rifle, Colorado - Rifle Oxygen_injection C3



Overview

Basic Information
IMG/M Taxon OID3300002095 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053054 | Gp0055715 | Ga0005089
Sample NameGroundwater microbial communities from Rifle, Colorado - Rifle Oxygen_injection C3
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size73108706
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Rifle, Colorado, Usa
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Soil Microbial Communities From Rifle, Colorado, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationRifle, Colorado, USA
CoordinatesLat. (o)39.534762Long. (o)-107.782602Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F050966Metagenome / Metatranscriptome144Y
F100657Metagenome / Metatranscriptome102Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
C687J26659_1003241Not Available1994Open in IMG/M
C687J26659_1007484Not Available1266Open in IMG/M
C687J26659_1014075Not Available876Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
C687J26659_1003241C687J26659_10032411F050966MSGSMWQGMKTRHGDGTEALSEEMESNGSATPKSRRHP
C687J26659_1007484C687J26659_10074841F100657IYMIYFINSHKEIMIMTQITISYTTSVXTPAGWRNETVTATVEVISPKRGRVLCVQDIGGNGNSGYGSRTGAKRQAYHVGGIAMREQGKIKNLSACCIL*
C687J26659_1014075C687J26659_10140751F050966MRENLMSGSRWQGMKTRHGDGTEALSEEMESNGSATPK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.