Sample 3300002029

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300002029

3300002029: Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - BBAY59

Overview

Basic Information
IMG/M Taxon OID	3300002029 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0103015 \| Gp0060463 \| Ga0016713
Sample Name	Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - BBAY59
Sequencing Status	Permanent Draft
Sequencing Center
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	398192442
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Delisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease
Type	Host-Associated
Taxonomy	Host-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Delisea Pulchra → Delisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Surface (saline)

Location Information
Location	Bare Island, Sydney, Australia
Coordinates	Lat. (^o)	-33.59	Long. (^o)	151.13	Alt. (m)	N/A	Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019484	Metagenome / Metatranscriptome	229	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
BBAY59_10060026	Not Available	639	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
BBAY59_10060026	BBAY59_100600262	F019484	YFSIFIYLAILGGSLKKIAKKITIKVPINKNTYTSASIIISYRC*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.