


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300002029 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0103015 | Gp0060463 | Ga0016713 |
| Sample Name | Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - BBAY59 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 398192442 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Delisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Delisea Pulchra → Delisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Surface (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Bare Island, Sydney, Australia | |||||||
| Coordinates | Lat. (o) | -33.59 | Long. (o) | 151.13 | Alt. (m) | N/A | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F019484 | Metagenome / Metatranscriptome | 229 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| BBAY59_10060026 | Not Available | 639 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| BBAY59_10060026 | BBAY59_100600262 | F019484 | YFSIFIYLAILGGSLKKIAKKITIKVPINKNTYTSASIIISYRC* |
| ⦗Top⦘ |