NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300002029

3300002029: Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - BBAY59



Overview

Basic Information
IMG/M Taxon OID3300002029 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0103015 | Gp0060463 | Ga0016713
Sample NameDelisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - BBAY59
Sequencing StatusPermanent Draft
Sequencing Center
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size398192442
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDelisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease
TypeHost-Associated
TaxonomyHost-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Delisea Pulchra → Delisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Surface (saline)

Location Information
LocationBare Island, Sydney, Australia
CoordinatesLat. (o)-33.59Long. (o)151.13Alt. (m)N/ADepth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019484Metagenome / Metatranscriptome229Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
BBAY59_10060026Not Available639Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
BBAY59_10060026BBAY59_100600262F019484YFSIFIYLAILGGSLKKIAKKITIKVPINKNTYTSASIIISYRC*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.