NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001931

3300001931: Marine microbial communities from Polynesia - GS045



Overview

Basic Information
IMG/M Taxon OID3300001931 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0055716 | Gp0056507 | Ga0016907
Sample NameMarine microbial communities from Polynesia - GS045
Sequencing StatusPermanent Draft
Sequencing CenterJ. Craig Venter Institute (JCVI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size636185
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Microbial Communities From Global Ocean Sampling (Gos)
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationPolynesia
CoordinatesLat. (o)-9.0175Long. (o)-127.76722Alt. (m)N/ADepth (m)1.7
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015022Metagenome / Metatranscriptome258Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
GOS2260_10282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique1975Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
GOS2260_10282GOS2260_102823F015022VYVILYCNVLATNDAAKILFKYPFGIGNHQINNDAANVNLIPIKRIGGKDSNAGLAITKPKPKKIGTKDATKVSFIFIPIFYINDY*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.