Basic Information | |
---|---|
IMG/M Taxon OID | 3300001927 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0055716 | Gp0056506 | Ga0016843 |
Sample Name | Marine microbial communities from Polynesia - GS044 |
Sequencing Status | Permanent Draft |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 562395 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → Viruses → Predicted Viral | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Marine Microbial Communities From Global Ocean Sampling (Gos) |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine biome → marine water body → sea water |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Polynesia | |||||||
Coordinates | Lat. (o) | -8.415 | Long. (o) | -124.23972 | Alt. (m) | N/A | Depth (m) | 2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F079363 | Metagenome / Metatranscriptome | 116 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
GOS2259_10090 | All Organisms → Viruses → Predicted Viral | 1329 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
GOS2259_10090 | GOS2259_100903 | F079363 | IKVYEEYNSIGLGGVYDLGIASLKLGYYTESEFDVDYLTLGGSIDAGIVDLSLAYYYNTDSFHNETLMISFGFDL* |
⦗Top⦘ |