| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300001927 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0055716 | Gp0056506 | Ga0016843 |
| Sample Name | Marine microbial communities from Polynesia - GS044 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 562395 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → Predicted Viral | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Microbial Communities From Global Ocean Sampling (Gos) |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Polynesia | |||||||
| Coordinates | Lat. (o) | -8.415 | Long. (o) | -124.23972 | Alt. (m) | N/A | Depth (m) | 2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F079363 | Metagenome / Metatranscriptome | 116 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| GOS2259_10090 | All Organisms → Viruses → Predicted Viral | 1329 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| GOS2259_10090 | GOS2259_100903 | F079363 | IKVYEEYNSIGLGGVYDLGIASLKLGYYTESEFDVDYLTLGGSIDAGIVDLSLAYYYNTDSFHNETLMISFGFDL* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |