Sample 3300001926

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300001926

3300001926: Marine microbial communities from the Tropical South Pacific Ocean - GS042

Overview

Basic Information
IMG/M Taxon OID	3300001926 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0055716 \| Gp0056504 \| Ga0016842
Sample Name	Marine microbial communities from the Tropical South Pacific Ocean - GS042
Sequencing Status	Permanent Draft
Sequencing Center	J. Craig Venter Institute (JCVI)
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	542583
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Predicted Viral	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Marine Microbial Communities From Global Ocean Sampling (Gos)
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine biome → marine water body → sea water
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	South Pacific Ocean
Coordinates	Lat. (^o)	-7.1075	Long. (^o)	-116.11916	Alt. (m)	N/A	Depth (m)	1.7
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004144	Metagenome / Metatranscriptome	451	Y
F094398	Metagenome / Metatranscriptome	106	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
GOS2257_10221	All Organisms → Viruses → Predicted Viral	1639	Open in IMG/M
GOS2257_10263	All Organisms → Viruses → Predicted Viral	1554	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
GOS2257_10221	GOS2257_102211	F094398	VLTSEFGISASTTISDWAQLRFTGTLNTNVDGETMRLKDLEGTNSDLDHRNNFAFPTDITQEPS*
GOS2257_10263	GOS2257_102632	F004144	MKNILKEAKYHLEIETGWSYQYHLWHSIKNSALLIKISFKSLVHGLLPFMWKSDAPKDIIILYHTIMKIQHIKKMDKLREVSKSKRYE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.