NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001924

3300001924: Marine microbial communities from Tikehau Lagoon, Polynesia Archipelagos - GS050



Overview

Basic Information
IMG/M Taxon OID3300001924 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0055716 | Gp0055807 | Ga0016840
Sample NameMarine microbial communities from Tikehau Lagoon, Polynesia Archipelagos - GS050
Sequencing StatusPermanent Draft
Sequencing CenterJ. Craig Venter Institute (JCVI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size467458
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Microbial Communities From Global Ocean Sampling (Gos)
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomelagoonsea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationTikehau Lagoon, Polynesia Archipelagos
CoordinatesLat. (o)-15.277778Long. (o)-148.22444Alt. (m)N/ADepth (m)1.2
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023608Metagenome / Metatranscriptome209Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
GOS2265_10029All Organisms → cellular organisms → Bacteria1415Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
GOS2265_10029GOS2265_100292F023608MNDITEEIGRIVNLLEDAVEEKDWSLVQKMIDELDEIYESFEKQDSGFGYDYNE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.