Basic Information | |
---|---|
IMG/M Taxon OID | 3300001924 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0055716 | Gp0055807 | Ga0016840 |
Sample Name | Marine microbial communities from Tikehau Lagoon, Polynesia Archipelagos - GS050 |
Sequencing Status | Permanent Draft |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 467458 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Marine Microbial Communities From Global Ocean Sampling (Gos) |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine biome → lagoon → sea water |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Tikehau Lagoon, Polynesia Archipelagos | |||||||
Coordinates | Lat. (o) | -15.277778 | Long. (o) | -148.22444 | Alt. (m) | N/A | Depth (m) | 1.2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F023608 | Metagenome / Metatranscriptome | 209 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
GOS2265_10029 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
GOS2265_10029 | GOS2265_100292 | F023608 | MNDITEEIGRIVNLLEDAVEEKDWSLVQKMIDELDEIYESFEKQDSGFGYDYNE* |
⦗Top⦘ |