NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001798

3300001798: Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Aug_8Ca



Overview

Basic Information
IMG/M Taxon OID3300001798 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053062 | Gp0055522 | Ga0004667
Sample NameSerpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Aug_8Ca
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size108343839
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → unclassified Methylococcales → Methylococcales bacterium1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSerpentinite Rock And Fluid Microbial Communities From Tablelands Ophiolite (Newfoundland), Coast Range Ophiolite (California) And Ligurian Springs (Italy)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid → Serpentinite Rock And Fluid Microbial Communities From Tablelands Ophiolite (Newfoundland), Coast Range Ophiolite (California) And Ligurian Springs (Italy)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeplanetary subsurface zonerock
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationUSA: California, McLaughlin Reserve
CoordinatesLat. (o)38.8739528Long. (o)-122.4391613Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025322Metagenome / Metatranscriptome202Y
F046955Metagenome / Metatranscriptome150Y
F054174Metagenome / Metatranscriptome140Y
F057919Metagenome / Metatranscriptome135Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI24126J20157_1000911All Organisms → cellular organisms → Bacteria8942Open in IMG/M
JGI24126J20157_1002250All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → unclassified Methylococcales → Methylococcales bacterium4684Open in IMG/M
JGI24126J20157_1005101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2510Open in IMG/M
JGI24126J20157_1024155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata665Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI24126J20157_1000911JGI24126J20157_10009114F025322MFDDVEGLDGEMKNIVALIDQVRGKLGDRFLRLELADHLAPKSTPFRVPSGLGAAIDKRIAPAGMDALNLFRAIRDVNKDVPDNPDKLDALVAAMGKLKQSLIPLTAEVAIQVGFK*
JGI24126J20157_1002250JGI24126J20157_10022502F046955MAAPRQMTANTLNALKGWPQPAAVDYHTEFDPSITDVVLPGSVVHLNSDGFYELGVGAEPVMPLFMFNGSDDPDVRNEGGDPATEKGVWIPINPTGQAMALVAVGAYELVSTAFDKTGTYNPNDPLTSPLSGGNAGKLIVGTLYTHMIVGFVSRGVVDNGYGHDGLAFWPFPVFPTP*
JGI24126J20157_1005101JGI24126J20157_10051015F054174MAWTDLISGCFGFGTAPFATNRPDEDSAKEAISAAQAEGATKAEFAQVIAMYPRKYIKSDQLLRERIREDAGRLDRLWKVSPVN*
JGI24126J20157_1024155JGI24126J20157_10241551F057919MLLSVSFHDISSLFGFFTFLIIANQLISGTMLAFSLVPEPMLIPVVRDEEDIEDLYTDDFF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.