NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001709

3300001709: Marine viral communities from the Pacific Ocean - LP-29



Overview

Basic Information
IMG/M Taxon OID3300001709 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0067852 | Gp0056770 | Ga0006056
Sample NameMarine viral communities from the Pacific Ocean - LP-29
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size40318590
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationPacific Ocean
CoordinatesLat. (o)48.9698Long. (o)-130.6666Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013050Metagenome / Metatranscriptome275Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI24509J20081_1000495Not Available9130Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI24509J20081_1000495JGI24509J20081_10004952F013050MSKGKQPRTRVKVPKLLLSEIKDVFFQNNQEIGLEAAIF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.