Basic Information | |
---|---|
IMG/M Taxon OID | 3300001665 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0096604 | Gp0056110 | Ga0012983 |
Sample Name | barSA |
Sequencing Status | Permanent Draft |
Sequencing Center | |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 7818637 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 1 |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Marine Microbial Communities From The Santa Barbara Basin, California, Usa |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Cold Seeps → Unclassified → Marine → Marine Microbial Communities From The Santa Barbara Basin, California, Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine cold seep biome → cold seep → marine sediment |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: California: Santa Barbara Basin | |||||||
Coordinates | Lat. (o) | 13.2648 | Long. (o) | -59.4253 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F037503 | Metagenome / Metatranscriptome | 168 | Y |
F095492 | Metagenome / Metatranscriptome | 105 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
SAud_103685 | Not Available | 561 | Open in IMG/M |
SAud_103801 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 553 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
SAud_103685 | SAud_1036851 | F095492 | EDIVSTHTNLEKSSKFEEVIMRTKATIVMFAIVLTAMLCPISALGTKTEAVETKAKLETLVDEYIACCAAKSALRHSRSEKIRNSAMRSCKKAAYCKRSKAELVEVMLENNIEPKAYKVRLFLNQKFSGALQAKE* |
SAud_103801 | SAud_1038011 | F037503 | MRLGAASRNSVIEVELLIRLGGFTTYQTLTNSECYDIYSGVRHRVLRSYAERETTQIIS* |
⦗Top⦘ |