NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001644

3300001644: Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF045



Overview

Basic Information
IMG/M Taxon OID3300001644 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0085736 | Gp0057370 | Ga0003884
Sample NameForest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF045
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size6868805
Sequencing Scaffolds4
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameForest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies

Alternative Ecosystem Assignments
Environment Ontology (ENVO)forest biomelandforest soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationHarvard Forest LTER, Petersham, MA, USA
CoordinatesLat. (o)42.550409Long. (o)-72.180244Alt. (m)N/ADepth (m)0 to .1
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004356Metagenome / Metatranscriptome442Y
F004500Metagenome / Metatranscriptome435Y
F046177Metagenome / Metatranscriptome151Y
F049144Metagenome / Metatranscriptome147N
F059191Metagenome / Metatranscriptome134Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI20279J16325_100458Not Available600Open in IMG/M
JGI20279J16325_100543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium573Open in IMG/M
JGI20279J16325_100602Not Available556Open in IMG/M
JGI20279J16325_100626All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis548Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI20279J16325_100458JGI20279J16325_1004581F004356MSKKKDRAWFVCPQWADMMARHYANDAEAGQALKADPKVLAKLRSRTPVPKSALLKMLHRLAERHDLGAAIGDLVVDTRSR*
JGI20279J16325_100543JGI20279J16325_1005431F059191IASESYTVVFYVPWMARAVQRRRPRIAAGWALVVAGSVARLRAAAAEPLR*
JGI20279J16325_100543JGI20279J16325_1005432F046177PQPDVLAGPESWQSQPPRRSRSWDSGSAADTFEDAIGEAVLGAATKAIGRVIGRKMRQAYNERIAPAMAARQEAVLNERVAIAQRHPDLRACLNDQVVFLVGGTRVLPLASAMQVRTVEQSDALVAQLRG*
JGI20279J16325_100602JGI20279J16325_1006021F004500TEPWRARLGAFCPRSTFPGTSVPGAGGGTGPAVVVQSVPRVRDKAVLAIPAPQSALAAQLGQMNNYNHMTSAYAFGEGASGPPPYREPV*
JGI20279J16325_100626JGI20279J16325_1006261F049144MRVLHLIRRIGALNRGNIITPRQIESACSARLAHTGHNRHSNDMTKPDLALSQIAARFTRHDVEWSRGAFMIIDRRTANPIARLRPIPDTDRFELFYWSNVKRRWTTFGNLGRMKLMLESAHEIVESDPMFRIPRGR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.