NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001638

3300001638: Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF039



Overview

Basic Information
IMG/M Taxon OID3300001638 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0085736 | Gp0057364 | Ga0003878
Sample NameForest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF039
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size2032065
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameForest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies

Alternative Ecosystem Assignments
Environment Ontology (ENVO)forest biomelandforest soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationHarvard Forest LTER, Petersham, MA, USA
CoordinatesLat. (o)42.550409Long. (o)-72.180244Alt. (m)N/ADepth (m)0 to .1
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032618Metagenome / Metatranscriptome179Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI20273J16310_10060All Organisms → cellular organisms → Bacteria1035Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI20273J16310_10060JGI20273J16310_100602F032618EVWLAHHGRAGLTPEDRAILAPRFQRLSRDAASVAALSQDMITEMRPAA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.