NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001629

3300001629: Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF006



Overview

Basic Information
IMG/M Taxon OID3300001629 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0085736 | Gp0057257 | Ga0003845
Sample NameForest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF006
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size1913971
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → Thiocapsa marina → Thiocapsa marina 58111
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameForest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies

Alternative Ecosystem Assignments
Environment Ontology (ENVO)forest biomelandforest soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationHarvard Forest LTER, Petersham, MA, USA
CoordinatesLat. (o)42.532967Long. (o)-72.209488Alt. (m)N/ADepth (m)0 to .1
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005285Metagenome / Metatranscriptome406Y
F015539Metagenome / Metatranscriptome254Y
F038357Metagenome / Metatranscriptome166Y
F086219Metagenome / Metatranscriptome111N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI20240J16301_10203All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium958Open in IMG/M
JGI20240J16301_10205All Organisms → cellular organisms → Bacteria943Open in IMG/M
JGI20240J16301_10450All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → Thiocapsa marina → Thiocapsa marina 5811593Open in IMG/M
JGI20240J16301_10483All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans567Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI20240J16301_10203JGI20240J16301_102031F038357MGVSAPLPHQGRAGLQHSAGIERTSASLELARQNPQAALQGAGWTALGALLQLIGEASDDQIATEAQRRSGVMQCPPRTPQLLCRPIDQSGNLAGFKLGQVPVSKSVVPDVDWTETGGRLARVLASRSVVEWRFHRFAGSAMRYTRPRSSLAEASVSPSFFFRVPEKTPRTV*
JGI20240J16301_10205JGI20240J16301_102051F005285ATSSSGETVSVGEGMHGVGGDRMAGSWSDMNQGSLFGKGTAFMIDERSEEPCPKGDRAFVRAKKRGNARGAKGGRKVEA*
JGI20240J16301_10450JGI20240J16301_104503F086219MNRSAEDGAWSSPHYGDEGAWVPLRRTKVCAGDTVGKSVSDSGRPGIVRRQGMAGIVRHSQTKGRATGNAKPSLKPAN
JGI20240J16301_10483JGI20240J16301_104831F015539VVQLQFLDLMIPKECGAVPMDAATRADLIDLMARVLVVVFHEEGGSVNDRRFVQCQDQTGAPGSEGD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.