x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300001628
3300001628: Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF021
Overview
Basic Information
IMG/M Taxon OID 3300001628 Open in IMG/M
GOLD Reference (Study | Sequencing Project | Analysis Project) Gs0085736 | Gp0057302 | Ga0003860
Sample Name Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF021
Sequencing Status Permanent Draft
Sequencing Center DOE Joint Genome Institute (JGI)
Published? N
Use Policy Open
Dataset Contents
Total Genome Size 1120616
Sequencing Scaffolds 1
Novel Protein Genes 1
Associated Families 1
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Forest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies
Type Environmental
Taxonomy Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies
Alternative Ecosystem Assignments
Environment Ontology (ENVO) forest biome → solid layer → forest soil
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
Location Information
Location Harvard Forest LTER, Petersham, MA, USA
Coordinates Lat. (o ) 42.471116 Long. (o ) -72.17263 Alt. (m) N/A Depth (m) 0 to .1
Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F071421 Metagenome / Metatranscriptome 122 N
Sequences
Scaffold ID Protein ID Family Sequence
JGI20255J16336_10006 JGI20255J16336_100061 F071421 VASRLRGTSPGYSWRSRVGYKEGAPPKGTQPGTAPGTQGSTEAAQQAIQLPPLSFPRDGPPQVHSSLTATMVCDMRLSGGGNLSPITPKSGYRFGPTPRNLARVVAIDQPPTDPIAACWENQQDFS*