NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001624

3300001624: Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF022



Overview

Basic Information
IMG/M Taxon OID3300001624 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0085736 | Gp0057303 | Ga0003861
Sample NameForest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF022
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size1487226
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameForest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies

Alternative Ecosystem Assignments
Environment Ontology (ENVO)forest biomesolid layerforest soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationHarvard Forest LTER, Petersham, MA, USA
CoordinatesLat. (o)42.471116Long. (o)-72.17263Alt. (m)N/ADepth (m)0 to .1
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024627Metagenome / Metatranscriptome205Y
F088851Metagenome / Metatranscriptome109Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI20256J16337_10071Not Available1422Open in IMG/M
JGI20256J16337_10132All Organisms → cellular organisms → Bacteria1152Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI20256J16337_10071JGI20256J16337_100712F088851VDSRLRRSPPDRASAVPYGQAGENAMRFPRLAHRSAAAHKLHSTPQQDRMNLISGKGETS
JGI20256J16337_10132JGI20256J16337_101322F024627MALDADRKNGPAARSFAADAHDCIMVRIKRPYRIQVCGTKMRPQWRAPLGFSKIDRHRQTLKLCRKKAPVAGHHRSACSGVKALRNTSDARRQAAKLCYRFGPLTPSARSANLIAGDGTKNGFPAPNKEPAKTKNHHLTGKAPYKFESISLPNGELPSDSQQTGTDQIPKLCNPCRSSSSLRVLKRQSLPLA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.