| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300001573 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053074 | Gp0054668 | Ga0000780 |
| Sample Name | Marine microbial communities from the Deep Pacific Ocean - MP1483 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 26213344 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosarchaeum | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | South of Fiji, South Pacific Ocean | |||||||
| Coordinates | Lat. (o) | -28.41 | Long. (o) | 179.14 | Alt. (m) | N/A | Depth (m) | 3501.1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006552 | Metagenome | 370 | Y |
| F013190 | Metagenome / Metatranscriptome | 273 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| JGI12176J15753_101453 | Not Available | 1902 | Open in IMG/M |
| JGI12176J15753_101951 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosarchaeum | 1518 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| JGI12176J15753_101453 | JGI12176J15753_1014531 | F006552 | ISPVLKIKSSRINPVANIPKPIPIAKKAIDILNNVGLPVFLNPIYEIVPITTPTKSPTKFRIISRKNSNYADSVTVLNKVSEQVF* |
| JGI12176J15753_101951 | JGI12176J15753_1019515 | F013190 | ATCDGSIPLNEMPSTVASKVASSTKVDIAEIIAFHSLEVFVLAENSNLIK* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |