NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001473

3300001473: Marine cyanobacterial communities from Panama - species 1 Leptolyngbya sp. v5



Overview

Basic Information
IMG/M Taxon OID3300001473 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0064184 | Gp0054795 | Ga0012422
Sample NameMarine cyanobacterial communities from Panama - species 1 Leptolyngbya sp. v5
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size366935825
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Cyanobacterial Communities From Panama, Similar To Oscillatoria Species
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Cyanobacterial Communities From Panama, Similar To Oscillatoria Species

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationPanama: Panama City
CoordinatesLat. (o)9.28Long. (o)-79.97Alt. (m)N/ADepth (m)48.85
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008191Metagenome / Metatranscriptome337Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI12316J15309_10000141All Organisms → cellular organisms → Bacteria632666Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI12316J15309_10000141JGI12316J15309_1000014152F008191MTARLTCADCRWWHFQSTETAASRDDEQAVGYCRRMPPERRENGVGAWPITFPTDWCGEYVHKDDVSYQIGEGFTAVS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.