NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001391

3300001391: Hydrothermal vent microbial communities from the Southwest Indian Ridge - SWIR1



Overview

Basic Information
IMG/M Taxon OID3300001391 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0090378 | Gp0055594 | Ga0012453
Sample NameHydrothermal vent microbial communities from the Southwest Indian Ridge - SWIR1
Sequencing StatusPermanent Draft
Sequencing Center
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size55292183
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHydrothermal Vent Microbial Communities From The Southwest Indian Ridge
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Hydrothermal Vent Microbial Communities From The Southwest Indian Ridge

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine hydrothermal vent biomemarine hydrothermal venthydrothermal fluid
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
Location
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008223Metagenome / Metatranscriptome337Y
F059476Metagenome / Metatranscriptome134Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
SWIR1_1016497Not Available993Open in IMG/M
SWIR1_1030884All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria557Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
SWIR1_1016497SWIR1_10164972F008223MGIFKKLFGKQAHTPTVTEAVGKIIDRFATATSMGVDREALARYPARQYQVMAFHYGAIDYLSQQHQLDETQTLGVFVIFINTYFTMPITETGSISERLRGFSEKPDERRYMEAGADAFRRWHEQNERRAPLELGEMLNKE*
SWIR1_1030884SWIR1_10308842F059476LVKKMAEQNNRQQSIRMVITVVLLVLLALGFFAASFFALS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.