| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300001386 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0092916 | Gp0055928 | Ga0012449 |
| Sample Name | Cayman MG2b |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 1872047 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Hydrothermal Vent Plume Microbial Communities From The Cayman Rise, Caribbean Sea |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From The Cayman Rise, Caribbean Sea |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine hydrothermal vent biome → marine hydrothermal plume → hydrothermal fluid |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Mid Cayman Rise | |||||||
| Coordinates | Lat. (o) | 18.43001 | Long. (o) | -81.46999 | Alt. (m) | N/A | Depth (m) | 4953 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005684 | Metagenome / Metatranscriptome | 393 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| MG2b_10023 | Not Available | 23783 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| MG2b_10023 | MG2b_1002311 | F005684 | VYDTEESPLSAMQVVRRESEVREGRLCNRNEPRQAHCEPERGRFPDRGWNEHPRRSKSKQVRMASTGPGRMHS* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |