NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001368

3300001368: Microbial communities from bioreactor (seeded with sewage sludge) at LBNL, California, USA - Biofuel metagenome 4



Overview

Basic Information
IMG/M Taxon OID3300001368 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0046201 | Gp0055637 | Ga0012398
Sample NameMicrobial communities from bioreactor (seeded with sewage sludge) at LBNL, California, USA - Biofuel metagenome 4
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size210438320
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Communities From Bioreactor (Seeded With Sewage Sludge) At Lbnl, California, Usa
TypeEngineered
TaxonomyEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Bioreactor → Microbial Communities From Bioreactor (Seeded With Sewage Sludge) At Lbnl, California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationLawrence Berkeley National Laboratory, California, USA
CoordinatesLat. (o)37.8754404Long. (o)-122.2477251Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F089576Metagenome109Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI20225J14565_1035626All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula1313Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI20225J14565_1035626JGI20225J14565_10356262F089576MFGLPDITIIVFGGVTLVAIVALLYWGLTFRGHD*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.