| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300001341 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0064184 | Gp0054795 | Ga0012423 |
| Sample Name | Marine cyanobacterial communities from Panama - species 1 Leptolyngbya sp. v3 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 414503233 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Cyanobacterial Communities From Panama, Similar To Oscillatoria Species |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Cyanobacterial Communities From Panama, Similar To Oscillatoria Species |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Panama: Panama City | |||||||
| Coordinates | Lat. (o) | 9.28 | Long. (o) | -79.97 | Alt. (m) | N/A | Depth (m) | 48.85 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F008191 | Metagenome / Metatranscriptome | 337 | Y |
| F094484 | Metagenome | 106 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| JGI12316J14372_10000462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 76861 | Open in IMG/M |
| JGI12316J14372_10054575 | Not Available | 877 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| JGI12316J14372_10000462 | JGI12316J14372_1000046213 | F008191 | LTCADCRWWHFQSTETAASRDDEQAVGYCRRMPPERRENGVGAWPITFPTDWCGEYVHKDDVSYQIGEGFTAVS* |
| JGI12316J14372_10054575 | JGI12316J14372_100545751 | F094484 | MKKITLALLLSGLVISAAGPAYAEGRRMLIFAIYGPDGSTGSSATTTVVDFTTQVACREARRAIH |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |