| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300001298 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0087381 | Gp0055900 | Ga0012468 |
| Sample Name | Permafrost soil microbial communities from Miers Valley, Antarctica - Ant1 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 53594645 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 2 |
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Permafrost Soil Microbial Communities From Miers Valley, Antarctica |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost Soil → Permafrost Soil Microbial Communities From Miers Valley, Antarctica |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → glacial lake → permafrost |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Lake Miers, Antarctica | |||||||
| Coordinates | Lat. (o) | -78.099535 | Long. (o) | 163.850256 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051905 | Metagenome | 143 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Bac131567_1046072 | Not Available | 4267 | Open in IMG/M |
| Bac131567_1194058 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 35414 | Open in IMG/M |
| Bac131567_1217264 | Not Available | 8997 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Bac131567_1046072 | Bac131567_10460722 | F051905 | MNDETIISSISVTDIVFDVYLGKWNYRAIPKAKTWSYFLTIP* |
| Bac131567_1194058 | Bac131567_119405828 | F051905 | MSFRNDETIISSISVTDIVFDVYLGKWNYRAILKVKTWSYFLTIP* |
| Bac131567_1217264 | Bac131567_12172646 | F051905 | MNGNYKLRNDETIISSISVTDIVFDVYLGKCNYRAIPKVKTWSYFLTIPN* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |