NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001287

3300001287: Freshwater microbial communities from Lake Mendota, WI - 23JUL2008 deep hole epilimnion



Overview

Basic Information
IMG/M Taxon OID3300001287 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063444 | Gp0055062 | Ga0000693
Sample NameFreshwater microbial communities from Lake Mendota, WI - 23JUL2008 deep hole epilimnion
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size9047866
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Eukaryota1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFreshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biomeepilimnionlake water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004315Metagenome / Metatranscriptome444Y
F018650Metagenome / Metatranscriptome234N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
B570J14243_100755Not Available1255Open in IMG/M
B570J14243_101037Not Available892Open in IMG/M
B570J14243_101142All Organisms → cellular organisms → Eukaryota817Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
B570J14243_100755B570J14243_1007552F004315DVLLLLCLHDFGLRVTVEVGQASAFLYSEARLYKGPSQSTLPQLTATRSTGNISVRTQKVNHSNTRGLVSSLFFSRSEITAALSLHFQHLYED*
B570J14243_101037B570J14243_1010373F004315FIMKVASDVLLLLCLHDFGLWVSVELGQASAFLYSEARLYKGPSQSALPQLTATRSTGNISVRTQKVNHSNTRGLVSSLFFSRSEITAALSLHFQHLYED*
B570J14243_101142B570J14243_1011421F018650EKYADWWTFKPSSPLKAYLSDREIVMDEYFSLDELRYQVMSILRHAAQFPNNSDVIVLEDQELQMVFDSWYIFVPDVVENHLLSHVIPAPADISNDLQNKHMTEDFYVDSPVDLIYKDPSSVFWIPSFVDFAMNQSTGNVGSWNKLLFMFTEFCLNNTTYFTRFSDCIIGINENTCLTSLFDFKYFHISQIETLLQKITKFLGRKNSIFQSCHFITHNPAFDITSIHPNVFTFIDDIINNNNDMMPDFQTGLYI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.