NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001246

3300001246: Freshwater microbial communities from Lake Mendota, WI - 23JUL2008 deep hole epilimnion



Overview

Basic Information
IMG/M Taxon OID3300001246 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0063444 | Gp0055062 | Ga0011697
Sample NameFreshwater microbial communities from Lake Mendota, WI - 23JUL2008 deep hole epilimnion
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size6511556
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota2
Not Available3
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4031

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFreshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biome → epilimnion → lake water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002515Metagenome / Metatranscriptome552Y
F018650Metagenome / Metatranscriptome234N
F049428Metagenome / Metatranscriptome146N
F053089Metagenome / Metatranscriptome141N
F083751Metagenome / Metatranscriptome112N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
B570J13874_100548All Organisms → cellular organisms → Eukaryota1392Open in IMG/M
B570J13874_100662Not Available991Open in IMG/M
B570J13874_100756All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403817Open in IMG/M
B570J13874_100783Not Available783Open in IMG/M
B570J13874_100838All Organisms → cellular organisms → Eukaryota723Open in IMG/M
B570J13874_100940Not Available643Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
B570J13874_100548B570J13874_1005482F018650HCRTCDRNGGPAKESIDHKYVDFIEKELLPKINSLAKKYTDWWTFKPSSPLKAYLSDHEIVMDEYFSLEELRCQVMSIIRHRAQLSNHNVIVLEDQELQMVFDSWYIFVPDVENHLLAHVIPAPADISNDLQNKHMTEEFYINSPVDLLYKDPSSVFWILPFVDFAMNQSTGNVRSWKKLLCMFTKFCLNNTTYFTRVSDSIIRINENTCLTSLFGFKYFHRSQIEHLLKKITKFLGRKNSMVQSCHFIKHNPVFNKTTKHQNVFAFIDDIINKNNDMMPDFQTGLYI*
B570J13874_100662B570J13874_1006621F083751EEMVVHIDFLILHKIFPLENALTEIMTLRKFVYLFKDLSSAYTVITRIGKFFVS*
B570J13874_100756B570J13874_1007562F002515MKKNAEELRRLMELRRSNAASAVPNKKKYNRKKCQSQMLKLSKESE*
B570J13874_100783B570J13874_1007831F049428REIRNKQVDTAHVLKFITWTLNINITVVKIIFRLPKNTGHQRFCLSYGFQNTFIKIIKTPNSFKPIHVITYKNKYYILNQLPTIFPLLLRNVNPQDQLTYKRIPVRADQILDIVQGRTDHLNFPFTINIYTAYSYTGKASNEIRTNMIGQLLAKKNTEEIFHVFLTPDIEQRNVIKINALENVKHSAKFDKHDLFTNTLITEGDKTVFKRSPKEVLLNQKNCICEHKETQDYSPLSRDRNLGIEQLL*
B570J13874_100838B570J13874_1008381F018650SSPLKAYLSDREIVMDEYFSLDELRYQVMSILRHAAQFPNNSDVIVLEDQELQMVFDSWYIFVPDVVENHLLSHVIPAPADISNDLQNKHMTEDFYVDSPVDLIYKDPSSVFWIPSFVDFAMNQSTGNVGSWNKLLFMFTEFCLNNTTYFTRFSDCIIGINENTCLTSLFDFKYFHISQIETLLQKITKFLGRKNSIFQSCHFITHNPAFDITSIHPNVFTFIDDIINNNNDMMPDFQTG
B570J13874_100940B570J13874_1009402F053089IIYKDPSSVFWIHPFVDFAMNRSTGNVGSWNKLLFMFTEFCLNNTTYFTRFSDSIIGINVNTSLTSLFDFKFFHLSQVETLLQQITKFLGRKNSMIQSCHFITHNPTFDYITSIHPNVFTFIDYIINNHNDMMPDFKTGIFNI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.