Sample 3300001225

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300001225

3300001225: Switchgrass rhizosphere microbial communities from Knoxville, Tennessee, USA - 11_joined

Overview

Basic Information
IMG/M Taxon OID	3300001225 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0087863 \| Gp0055701 \| Ga0012560
Sample Name	Switchgrass rhizosphere microbial communities from Knoxville, Tennessee, USA - 11_joined
Sequencing Status	Permanent Draft
Sequencing Center	University of Tennessee
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	5351985
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Bacteria → Proteobacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Switchgrass Rhizosphere Microbial Communities From Knoxville, Tennessee, Usa
Type	Host-Associated
Taxonomy	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Knoxville, Tennessee, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere

Location Information
Location	East Tennessee Research and Education Center, Knoxville, Tennessee, USA
Coordinates	Lat. (^o)	35.9606	Long. (^o)	-83.9208	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020839	Metagenome / Metatranscriptome	221	Y
F061048	Metagenome / Metatranscriptome	132	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
SwM_106623	Not Available	582	Open in IMG/M
SwM_113819	All Organisms → cellular organisms → Bacteria → Proteobacteria	510	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
SwM_106623	SwM_1066231	F020839	PRTAPAAAQSAQKTAAPGTGTGAPQMDQRLLTNTWPKQCTIISIQANTNKN*
SwM_113819	SwM_1138192	F061048	MSLDLVALKDEPSTTRNARPRRSLDLETESVVRVLPIRWRLFS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.