Sample 3300001200

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300001200

3300001200: Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY65

Overview

Basic Information
IMG/M Taxon OID	3300001200 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0085351 \| Gp0054609 \| Ga0012575
Sample Name	Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY65
Sequencing Status	Permanent Draft
Sequencing Center	J. Craig Venter Institute (JCVI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	729179300
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Macroalgal Surface Microbial Communities
Type	Host-Associated
Taxonomy	Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface → Macroalgal Surface Microbial Communities

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Surface (saline)

Location Information
Location	Botany Bay, Sydney, NSW, Australia
Coordinates	Lat. (^o)	-33.966629	Long. (^o)	151.166614	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082766	Metagenome / Metatranscriptome	113	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
BBAY65_12186645	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	516	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
BBAY65_12186645	BBAY65_121866452	F082766	MANFEKLFQTAVPLYCPVEDNEGNMYVVSTNGEVYLTNDGQMNPAFSTGGQPTSLVFDQEGSAFIADMGY*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.