x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300001142
3300001142: Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M1
Overview
| Basic Information |
| IMG/M Taxon OID | 3300001142 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0071004 | Gp0054858 | Ga0002984 |
| Sample Name | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M1 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 1720555 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1 |
| All Organisms → cellular organisms → Bacteria | 1 |
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Forest Soil Microbial Communities From Multiple Locations In Canada And Usa |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | forest biome → solid layer → forest soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information |
| Location | Algoma, Ontario, Canada |
| Coordinates | Lat. (o) | 46.42 | Long. (o) | -83.37 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F000321 | Metagenome / Metatranscriptome | 1304 | Y |
| F025163 | Metagenome / Metatranscriptome | 203 | Y |
| F092578 | Metagenome / Metatranscriptome | 107 | Y |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| JGI12702J13316_10019 | JGI12702J13316_100191 | F092578 | LKRRKKKGGELPVDLVKLVKIAISPVLGKGLAEFEVAFTNP |
| JGI12702J13316_10279 | JGI12702J13316_102791 | F025163 | AMQLALAFLEPSPPARPSPSQKLDAETRAEALNILARIIAQACETTQHTEATDE* |
| JGI12702J13316_10388 | JGI12702J13316_103881 | F000321 | VPKRRSANFGVYNVRLLSSLDKLLRDKPRFMGELSTSINDALLAVDLNTVELVTLQSRQKQTGRETQVVILNRLRKRIHDVAKKRNCSMNQLVNSALLVFYSKGGESKLKKPAKGRDSSVHSYDRMTEAERRELHQMLAELSAMQSVPFEAEEPNGSYYEYDRNLKATVKVTPD |
