NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001080

3300001080: Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O3



Overview

Basic Information
IMG/M Taxon OID3300001080 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0071004 | Gp0055381 | Ga0002903
Sample NameForest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O3
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size1443535
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameForest Soil Microbial Communities From Multiple Locations In Canada And Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)forest biomelandforest soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationDavy Crockett National Forest, Groveton, Texas, USA
CoordinatesLat. (o)31.11Long. (o)-95.15Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000837Metagenome / Metatranscriptome868Y
F027616Metagenome / Metatranscriptome194Y
F073320Metagenome / Metatranscriptome120Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI12674J13244_10085Not Available710Open in IMG/M
JGI12674J13244_10095Not Available670Open in IMG/M
JGI12674J13244_10230Not Available501Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI12674J13244_10085JGI12674J13244_100852F027616HYLAKVFRHPLYPRLEMTSTSFAVQGTSGARMVVYTPDNEATRAAMEELVAGPVDHHFPCWPAHQARTRDLLTI*
JGI12674J13244_10095JGI12674J13244_100951F073320GGXSXXXHXSWTCAXRAPEAASGPLGTVASSSARHGRLRRNAVSPHGVRLSGAPGAPLWNGCSSANRALAGKLLWDGIIAVPEVFAAGCLVLFSAEEPSVDEHGQSGGSERSGDAGERHSRPDAPRPISLTCGYMATHGGTQGVAGIVDIRRLSEQRESTLAPRGAAVPGRRA*
JGI12674J13244_10230JGI12674J13244_102301F000837EFPLLANSGRNLTVPFTALADALKHNAAHINTAHLSPIDIAMLEYATLAIFILAGFAVLMITSAPGHERLAFVFFVLQLGLLSSEIWTSTFGEGRSLIEPYLMALVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.