NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001078

3300001078: Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O2



Overview

Basic Information
IMG/M Taxon OID3300001078 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0071004 | Gp0055312 | Ga0002920
Sample NameForest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O2
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size5533486
Sequencing Scaffolds7
Novel Protein Genes8
Associated Families8

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata1
Not Available1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameForest Soil Microbial Communities From Multiple Locations In Canada And Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)forest biomelandforest soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationDavy Crockett National Forest, Groveton, Texas, USA
CoordinatesLat. (o)31.11Long. (o)-95.15Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000579Metagenome / Metatranscriptome1011Y
F013050Metagenome / Metatranscriptome275Y
F018720Metagenome / Metatranscriptome233Y
F020104Metagenome / Metatranscriptome226Y
F039163Metagenome / Metatranscriptome164Y
F056810Metagenome137Y
F098798Metagenome / Metatranscriptome103Y
F103371Metagenome101Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI12640J13246_100107All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1990Open in IMG/M
JGI12640J13246_100162All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata1388Open in IMG/M
JGI12640J13246_100520Not Available689Open in IMG/M
JGI12640J13246_100617All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium632Open in IMG/M
JGI12640J13246_100699All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria601Open in IMG/M
JGI12640J13246_100714All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium597Open in IMG/M
JGI12640J13246_100727All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium592Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI12640J13246_100107JGI12640J13246_1001071F039163MSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKTQC*
JGI12640J13246_100162JGI12640J13246_1001622F013050MSKGKQPRTRVIKVPKLLLSEIKEVFIVYNQEIGLEAAIF*
JGI12640J13246_100520JGI12640J13246_1005202F018720MSASSSRMGVAAFIAVLTVSAGTMLYLFWHFPLITAVVTVGVLAALGVLARLARSIDGIKDMDRTEQSV*
JGI12640J13246_100617JGI12640J13246_1006172F020104MARSLKTSYLLLALGVSAVLALLLGGLAYYEHRITTSDANQLTYATVEEKLETDLQARARSLSNITSSSLAAA
JGI12640J13246_100699JGI12640J13246_1006991F056810MEFMSIVDAKARAPAGCAAVGVYENGDLGIAARQLDKQLAGMITSLHGSGDFS
JGI12640J13246_100714JGI12640J13246_1007141F000579VVVDNATTISVIDFRRQSMALLWHSLGGTWTACDTPPALVHGIAYIRPTGPNICIFGQGGRLRLQVGPNQYALAENSPRITCTRGIASFGFRRRFTVRSSSGGVLFTDSYWTHQGRDFFRWLADKAEDP
JGI12640J13246_100727JGI12640J13246_1007271F098798FTINNNLNKQAKLTPAFYIKQRKNRKTIKGSKKYKIFLVGDIIEFLFVFKSVPLLYSGICIAVRKKSFIMPDVTLILRNIIMKVAIEITVSFFYNRIYKLRFLDYKRKFYFYNKNKIFFIRKRLNKESRVGD*
JGI12640J13246_100776JGI12640J13246_1007762F103371MELPGYDDWKTHNPDDDRCEFCGMHPREWSAGWQPTRCTGECGLSWRDPDFEYEQARDDAQFFGNDIQANDDEY*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.