Sample 3300001073

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300001073

3300001073: Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 2

Overview

Basic Information
IMG/M Taxon OID	3300001073 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0053054 \| Gp0054640 \| Ga0001350
Sample Name	Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 2
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	13983289
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Soil Microbial Communities From Rifle, Colorado, Usa
Type	Environmental
Taxonomy	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	terrestrial biome → land → soil
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Subsurface (non-saline)

Location Information
Location	Rifle, Colorado, United States
Coordinates	Lat. (^o)	39.53	Long. (^o)	-107.78	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025141	Metagenome / Metatranscriptome	203	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
C687J13245_100092	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae	3732	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
C687J13245_100092	C687J13245_1000924	F025141	IVCEYCPEKFVENMNGLVEKTFHELLHEPEMVNK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.