NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001073

3300001073: Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 2



Overview

Basic Information
IMG/M Taxon OID3300001073 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053054 | Gp0054640 | Ga0001350
Sample NameSoil microbial communities from Rifle, Colorado, USA - sediment 13ft 2
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size13983289
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Rifle, Colorado, Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomelandsoil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationRifle, Colorado, United States
CoordinatesLat. (o)39.53Long. (o)-107.78Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025141Metagenome / Metatranscriptome203Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
C687J13245_100092All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae3732Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
C687J13245_100092C687J13245_1000924F025141IVCEYCPEKFVENMNGLVEKTFHELLHEPEMVNK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.