Sample 3300001006

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300001006

3300001006: Marine microbial communities from the Deep Atlantic Ocean - MP0758

Overview

Basic Information
IMG/M Taxon OID	3300001006 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0053074 \| Gp0054789 \| Ga0000799
Sample Name	Marine microbial communities from the Deep Atlantic Ocean - MP0758
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	9110632
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Deep Ocean Microbial Communities From The Global Malaspina Expedition
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine biome → marine water body → sea water
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	West of Cape Town, South Africa, South Atlantic Ocean
Coordinates	Lat. (^o)	-32.81	Long. (^o)	12.77	Alt. (m)	N/A	Depth (m)	3901.64
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094378	Metagenome / Metatranscriptome	106	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
JGI12027J13101_100912	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter	1403	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI12027J13101_100912	JGI12027J13101_1009121	F094378	NHPGNSQAKGPYIITLERRRSLTEGAKLSGNKTDGVF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.