| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300001004 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053074 | Gp0054439 | Ga0000750 |
| Sample Name | Marine microbial communities from the Deep Atlantic Ocean - MMD3.0 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 334105 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Balearic Sea, Spain | |||||||
| Coordinates | Lat. (o) | 40.83194 | Long. (o) | 2.44806 | Alt. (m) | N/A | Depth (m) | 1500 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024806 | Metagenome / Metatranscriptome | 204 | Y |
| F026012 | Metagenome / Metatranscriptome | 199 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| JGI12096J13111_10144 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| JGI12096J13111_10130 | JGI12096J13111_101302 | F026012 | PIERDFLLQALYSIVISLQNNLSINFFDMWVYDIYINKVSSHNKFMNEKSQNIETDEYITIKLAYGFNVSQEKK* |
| JGI12096J13111_10144 | JGI12096J13111_101441 | F024806 | MVKNSDFNFTDTSTVTLELPFSEHIEELRQRFFHIFWIILFLTCVAFLEVKLLVKI |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |