NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300000985

3300000985: Sinkhole freshwater microbial communities from Lake Huron, USA - r2gDNA Night3



Overview

Basic Information
IMG/M Taxon OID3300000985 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0045862 | Gp0056068 | Ga0011757
Sample NameSinkhole freshwater microbial communities from Lake Huron, USA - r2gDNA Night3
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Michigan
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size35639022
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSinkhole Freshwater Microbial Communities From Lake Huron, Us
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater → Sinkhole Freshwater Microbial Communities From Lake Huron, Us

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biomesinkholefresh water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationMiddle Island Sinkhole, Lake Huron Michigan, USA
CoordinatesLat. (o)45.19843Long. (o)-83.32721Alt. (m)N/ADepth (m)23
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F058147Metagenome135Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
KEY_1038286All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes15937Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
KEY_1038286KEY_10382862F058147MQRQSIIVFIQGNRIETYGNLKKCCEFEKLKYHTLARLKFPIMVNDIVIHKTMFK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.