Sample 3300000985

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300000985

3300000985: Sinkhole freshwater microbial communities from Lake Huron, USA - r2gDNA Night3

Overview

Basic Information
IMG/M Taxon OID	3300000985 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0045862 \| Gp0056068 \| Ga0011757
Sample Name	Sinkhole freshwater microbial communities from Lake Huron, USA - r2gDNA Night3
Sequencing Status	Permanent Draft
Sequencing Center	University of Michigan
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	35639022
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Sinkhole Freshwater Microbial Communities From Lake Huron, Us
Type	Environmental
Taxonomy	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater → Sinkhole Freshwater Microbial Communities From Lake Huron, Us

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	freshwater lake biome → sinkhole → fresh water
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline)

Location Information
Location	Middle Island Sinkhole, Lake Huron Michigan, USA
Coordinates	Lat. (^o)	45.19843	Long. (^o)	-83.32721	Alt. (m)	N/A	Depth (m)	23
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058147	Metagenome	135	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
KEY_1038286	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	15937	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
KEY_1038286	KEY_10382862	F058147	MQRQSIIVFIQGNRIETYGNLKKCCEFEKLKYHTLARLKFPIMVNDIVIHKTMFK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.