| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300000981 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053074 | Gp0054499 | Ga0000789 |
| Sample Name | Marine microbial communities from the Deep Indian Ocean - MP1201 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 197523793 |
| Sequencing Scaffolds | 0 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Army Ant Gut Microbial Communities |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Neotropical Army Ants Gut → Army Ant Gut Microbial Communities |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | South Indian Ocean | |||||||
| Coordinates | Lat. (o) | 10.306961 | Long. (o) | 103.31 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F103878 | Metagenome / Metatranscriptome | 101 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| JGI11929J13085_102079 | JGI11929J13085_1020792 | F103878 | ADDKKVPFLSSYINCTKNGISINVPKVIRSTPIAKKTVLLLFIFEVGGYFKIFEIQHNKT |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |