NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300000978

3300000978: Marine microbial communities from the Deep Indian Ocean - MP1140



Overview

Basic Information
IMG/M Taxon OID3300000978 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053074 | Gp0054695 | Ga0000791
Sample NameMarine microbial communities from the Deep Indian Ocean - MP1140
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size1166769
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDeep Ocean Microbial Communities From The Global Malaspina Expedition
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationSouth Indian Ocean
CoordinatesLat. (o)-29.65Long. (o)92.99Alt. (m)N/ADepth (m)2402.15
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F052657Metagenome / Metatranscriptome142N
F063774Metagenome / Metatranscriptome129N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI12188J13089_10024All Organisms → cellular organisms → Eukaryota1574Open in IMG/M
JGI12188J13089_10147Not Available746Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI12188J13089_10024JGI12188J13089_100243F063774MLYMRCRCEHLLSASRKRLEAARVCAFAARISTFAEHHLEEVARDNSLRRGDGRWRGHHSVDPSERRTERTFGSTGPGRAKLERGGVNLDHFGEEIRFENDSVLLAMVGIIATRAESAEAA*
JGI12188J13089_10147JGI12188J13089_101471F052657MNATASASLELRSALQAHGDQLDTELRLLRELPQVYLTEKCVFDRGNGRIAKKRVAICSLRCCGEQLDQKSKCNDFSGERACPTVVDAVRFLRAKVENCHGVIGRSRCISFEFFC

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.