Sample 3300000969

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300000969

3300000969: Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY82

Overview

Basic Information
IMG/M Taxon OID	3300000969 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0085351 \| Gp0056477 \| Ga0011743
Sample Name	Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY82
Sequencing Status	Permanent Draft
Sequencing Center	J. Craig Venter Institute (JCVI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	621148518
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Macroalgal Surface Microbial Communities
Type	Host-Associated
Taxonomy	Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface → Macroalgal Surface Microbial Communities

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Surface (saline)

Location Information
Location	Botany Bay, Sydney, NSW, Australia
Coordinates	Lat. (^o)	-33.966629	Long. (^o)	151.166614	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085143	Metagenome	111	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
BBAY82_10071799	Not Available	949	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
BBAY82_10071799	BBAY82_100717991	F085143	MTKRLDDGYQTLVTFAQEENVKFWEKSVTPPGVDAGGETDTTTMHNTDWRTKSPKALKMLTESSMTAAYDPAVYPQIVTMVGVNQLITITYPDGDTLAFWGWIDKFTPGDHVEGEQPTADVTIMPSNQDDTGAEVGPVHTLASVS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.