NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300000946

3300000946: Marine microbial communities from the Deep Atlantic Ocean - MP0555



Overview

Basic Information
IMG/M Taxon OID3300000946 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053074 | Gp0054073 | Ga0000805
Sample NameMarine microbial communities from the Deep Atlantic Ocean - MP0555
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size22429581
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDeep Ocean Microbial Communities From The Global Malaspina Expedition
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationSouth Atlantic Ocean
CoordinatesLat. (o)-26.91Long. (o)-21.43Alt. (m)N/ADepth (m)3199.21
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032684Metagenome / Metatranscriptome179Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI11838J13071_103790All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1031Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI11838J13071_103790JGI11838J13071_1037903F032684MILLCTLRVLALIDKFKSNFSVFKVMFLPFGIITKNTLKNIIQPKITPTDKNANLDPKNFVKQNEITAPIMSSTTIKIILLFINLDLQIRS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.